General Information

  • ID:  hor006649
  • Uniprot ID:  P81879
  • Protein name:  Somatostatin-2
  • Gene name:  sst2
  • Organism:  Piaractus mesopotamicus (Pacu)
  • Family:  Somatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Piaractus (genus), Serrasalmidae (family), Characoidei (suborder), Characiformes (order), Characiphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GRSHMVLNSALEGARGGPGGEEIPERFSIPELQWMLSNAELAPVQADEPPQSRMDLV
  • Length:  57
  • Propeptide:  GRSHMVLNSALEGARGGPGGEEIPERFSIPELQWMLSNAELAPVQADEPPQSRMDLV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Somatostatin inhibits the release of somatotropin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81879-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P81879-F1.pdbhor006649_AF2.pdbhor006649_ESM.pdb

Physical Information

Mass: 717097 Formula: C266H423N77O86S3
Absent amino acids: CKTY Common amino acids: EGLP
pI: 4.19 Basic residues: 5
Polar residues: 13 Hydrophobic residues: 18
Hydrophobicity: -44.21 Boman Index: -9782
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78.77
Instability Index: 6795.61 Extinction Coefficient cystines: 5500
Absorbance 280nm: 98.21

Literature

  • PubMed ID:  10327603
  • Title:  Purification and characterization of insulin and peptides derived from proglucagon and prosomatostatin from the fruit-eating fish, the pacu Piaractus mesopotamicus.